Scaffold MIS_10011302

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold MIS_10011302

Scaffold MIS_10011302

Overview

Basic Information
Taxon OID	3300002026 Open in IMG/M
Scaffold ID	MIS_10011302 Open in IMG/M
Source Dataset Name	Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Michigan
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	9512
Total Scaffold Genes	23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	21 (91.30%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Source Dataset Sampling Location
Location Name	Middle Island Sinkhole, Lake Huron Michigan, USA
Coordinates	Lat. (^o)	45.19843	Long. (^o)	-83.32721	Alt. (m)		Depth (m)	23
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018683	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
MIS_1001130212	F018683	AGGA	MVKRFKQSQRFRVILGDVCFYATAKQIRYGVGDFMKCNAALQKALDSLEYMPNSVYKPVGAVGTWEGLTVQINVCNK*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.