Scaffold MIS_10005856

Overview

Basic Information

• Taxon OID: 3300002026
• Scaffold ID: MIS_10005856
• Source Dataset Name: Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 5k+
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: University of Michigan
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 19535
• Total Scaffold Genes: 22
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (9.09%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater → Sinkhole Freshwater Microbial Communities From Lake Huron, Us

Source Dataset Sampling Location

• Location Name: Middle Island Sinkhole, Lake Huron Michigan, USA
• Coordinates
  • Lat. (^o): 45.19843
  • Long. (^o): -83.32721
  • Depth (m): 23

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087946	Metagenome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
MIS_1000585621	F087946	N/A	MLSKQRIPDLIVIAVLGLLLVLLNYTGNIGIMSDYPFIFLLVMYFLGRAVTWYIINQHMDEGDGGKEQE*