Scaffold Draft_11235240

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Draft_11235240

Scaffold Draft_11235240

Overview

Basic Information
Taxon OID	3300001975 Open in IMG/M
Scaffold ID	Draft_11235240 Open in IMG/M
Source Dataset Name	Biogas fermenter microbial communities from the University of Hamburg, Germany
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	569
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany

Source Dataset Sampling Location
Location Name	University of Hamburg, Germany
Coordinates	Lat. (^o)	53.458783	Long. (^o)	9.968812	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F065565	Metagenome / Metatranscriptome	127	N

Sequences

Protein ID	Family	RBS	Sequence
Draft_112352401	F065565	AGGAGG	MSFLKVLNILVTAAGFIIPLALLLEAEELPGERKEKKAVLAQLKAQLDSLGLEFPQWLQKFIDPILGLLIDAVVFWASN*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.