Scaffold Draft_11049311

Overview

Basic Information

• Taxon OID: 3300001975
• Scaffold ID: Draft_11049311
• Source Dataset Name: Biogas fermenter microbial communities from the University of Hamburg, Germany
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 538
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Landfill → Unclassified → Unclassified → Biogas Fermenter → Biogas Fermenter Microbial Communities From The University Of Hamburg, Germany

Source Dataset Sampling Location

• Location Name: University of Hamburg, Germany
• Coordinates
  • Lat. (^o): 53.458783
  • Long. (^o): 9.968812

Associated Families

Family	Category	Number of Sequences	3D Structure?
F105431	Metagenome / Metatranscriptome	100	N

Sequences

Protein ID	Family	RBS	Sequence
Draft_110493112	F105431	AGAAGG	MDNDSTIKLIEKYGMHNRGKSKLISYLKGEHITRKEAIYAYCYDCQGYCEDGKVECDQTQCPLYMYSQFNKYNINKREKK*FL*