Scaffold GOS2246_10187720

Overview

Basic Information

• Taxon OID: 3300001974
• Scaffold ID: GOS2246_10187720
• Source Dataset Name: Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1650
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Upwelling, Fernandina Island, Equador
• Coordinates
  • Lat. (^o): -0.3011111
  • Long. (^o): -91.651665
  • Depth (m): 12

Associated Families

Family	Category	Number of Sequences	3D Structure?
F005243	Metagenome / Metatranscriptome	407	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2246_101877202	F005243	N/A	MADVKNLNPDLQDKNPQLTKEELTARREEITQFYKDNIPHLTVQAEYEALLAEIDKSRAERLQAQLFLAQAAAAQKENAEGPSSEEKAFKEAMEKAAANVE*