Basic Information | |
---|---|
Taxon OID | 3300001974 Open in IMG/M |
Scaffold ID | GOS2246_10049508 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Upwelling, Fernandina Island, Equador - GS031 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1338 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Upwelling, Fernandina Island, Equador | |||||||
Coordinates | Lat. (o) | -0.3011111 | Long. (o) | -91.651665 | Alt. (m) | Depth (m) | 12 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F095628 | Metagenome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2246_100495082 | F095628 | N/A | MIAIKDHFWKICCIVYMYFIYVESCIRNTSAALVMKYGIVPLYDLQASSYAYKMRI* |
⦗Top⦘ |