Scaffold GOS2217_10122300

Overview

Basic Information

• Taxon OID: 3300001973
• Scaffold ID: GOS2217_10122300
• Source Dataset Name: Marine microbial communities from Bermuda, Atlantic Ocean - GS001
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3569
• Total Scaffold Genes: 8
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (12.50%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → unclassified viruses → unclassified DNA viruses → unclassified dsDNA viruses → Prokaryotic dsDNA virus sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Bermuda, Atlantic Ocean
• Coordinates
  • Lat. (^o): 32.166668
  • Long. (^o): -64.5
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030401	Metagenome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2217_101223005	F030401	GGA	MDSLFGGSGIRTLRNMVRKGLIKQEDLDNPPSGWFLSMGYERENGSGRWKRTIRTKSGATSSIPVHKLPKYKNVLTGKITFDPVMYEKQY*