Scaffold GOS2216_10086114

Overview

Basic Information

• Taxon OID: 3300001972
• Scaffold ID: GOS2216_10086114
• Source Dataset Name: Marine microbial communities from the Sargasso Sea - GS000d
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1849
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (14.29%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Pseudomonadales → Marinobacteraceae → Marinobacter → unclassified Marinobacter → Marinobacter sp. (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Sargasso Sea
• Coordinates
  • Lat. (^o): 31.175
  • Long. (^o): -64.32433
  • Depth (m): 5

Associated Families

Family	Category	Number of Sequences	3D Structure?
F030401	Metagenome	185	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2216_100861146	F030401	GGA	MDSLFNASGIRTLRKMVKKGLIKVEDLDTPPSGWFITMGYDRENKTGKWKRITRTECGAIPSLPVHKLPKYKNVLTGKITFDPVEYEKQY*