Scaffold GOS2248_10002167

Overview

Basic Information

• Taxon OID: 3300001970
• Scaffold ID: GOS2248_10002167
• Source Dataset Name: Hypersaline microbial communities from Punta Cormorant, Floreana Island, Equador - GS033
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 638
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Punta Cormorant, Floreana Island, Equador
• Coordinates
  • Lat. (^o): -1.2283334
  • Long. (^o): -90.42917
  • Depth (m): .2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F058114	Metagenome / Metatranscriptome	135	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2248_100021671	F058114	GGAGG	MIEITFTREELSHLYDVLLKNHLQVKQSVMNKIDEELIADEIFELLGELECLDTYLNDEWQDKLWYDDPEDEYTIAVKRCRNLWNRQTIAELKSIIAKLEENK