Scaffold GOS2233_1012817

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold GOS2233_1012817

Scaffold GOS2233_1012817

Overview

Basic Information
Taxon OID	3300001969 Open in IMG/M
Scaffold ID	GOS2233_1012817 Open in IMG/M
Source Dataset Name	Marine microbial communities from Yucatan Channel, Mexico - GS017
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	J. Craig Venter Institute (JCVI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2398
Total Scaffold Genes	10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (60.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Predicted Viral	(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location
Location Name	Yucatan Channel, Mexico
Coordinates	Lat. (^o)	20.5225	Long. (^o)	-85.41361	Alt. (m)		Depth (m)	2
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F036278	Metagenome	170	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2233_10128174	F036278	GAGG	MTQDYQPEGKKYHFPDDDPYQESDEIYYNMVDFLDDSEVHQIWEIVGKALDRNNIVTTDNESLSVRVYDELSEED*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.