Basic Information | |
---|---|
Taxon OID | 3300001967 Open in IMG/M |
Scaffold ID | GOS2242_1056682 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Devil's Crown, Floreana Island, Equador - GS027 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1701 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 3 (60.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Devil's Crown, Floreana Island, Equador | |||||||
Coordinates | Lat. (o) | -1.2161111 | Long. (o) | -90.422775 | Alt. (m) | Depth (m) | 2.2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048364 | Metagenome / Metatranscriptome | 148 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2242_10566822 | F048364 | N/A | MKRLILILSLLFASVSYAEHEKQEGDLKKYDFWWEQIPVVCSYTSEVQRWANDKNFIPVNMSVGREGGVPEGRIVYVVVYYINDKGETFASVQTPESPDQSCITFRTFDLRINE |
⦗Top⦘ |