Basic Information | |
---|---|
Taxon OID | 3300001966 Open in IMG/M |
Scaffold ID | GOS2245_1084968 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Roca Redonda, Equador - GS030 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 828 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Flammeovirgaceae → unclassified Flammeovirgaceae → Flammeovirgaceae bacterium TMED32 | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Roca Redonda, Equador | |||||||
Coordinates | Lat. (o) | 0.27222222 | Long. (o) | -91.63333 | Alt. (m) | Depth (m) | 19 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F081752 | Metagenome / Metatranscriptome | 114 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2245_10849682 | F081752 | N/A | MINITIYEIIAAITGILLFWILQYSAEKDEYDNKNEKVKFIGFCQKWWAKHNDNILVHFVLTGFLLVIGIENTKNMLSEYFEIPSGMDGLGASGFIGFSGSLISDILKKMIKALKK* |
⦗Top⦘ |