Scaffold GOS2245_1012064

Overview

Basic Information

• Taxon OID: 3300001966
• Scaffold ID: GOS2245_1012064
• Source Dataset Name: Marine microbial communities from Roca Redonda, Equador - GS030
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1084
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Spirochaetes → unclassified Spirochaetota → Spirochaetota bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Roca Redonda, Equador
• Coordinates
  • Lat. (^o): 0.27222222
  • Long. (^o): -91.63333
  • Depth (m): 19

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077199	Metagenome / Metatranscriptome	117	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2245_10120641	F077199	AGAAG	MAIVKQVQKKVIMSKKDIIKFQLITHCYLNKITVSNSDLECLTLLSIIGPLELTHFCYDAAEEHKIFKSQQTVRNCINKCIKSNLIIKDSKNKKLIKINQKLNIETLGTVLLDFKFLAK*