Scaffold GOS2240_1003252

Overview

Basic Information

• Taxon OID: 3300001961
• Scaffold ID: GOS2240_1003252
• Source Dataset Name: Marine microbial communities from Dirty Rock, Cocos Island, Costa Rica - GS025
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1914
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Dirty Rock, Cocos Island, Costa Rica
• Coordinates
  • Lat. (^o): 5.552778
  • Long. (^o): -87.087776
  • Depth (m): 1.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F084357	Metagenome	112	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2240_10032525	F084357	GAG	MKNYLSNSKQNEYLKLDPNLKIHFKIINGVRYWLTPPPTDYQK*