Scaffold GOS2247_1050994

Overview

Basic Information

• Taxon OID: 3300001959
• Scaffold ID: GOS2247_1050994
• Source Dataset Name: Mangrove swamp microbial communities from Isabella Island, Equador - GS032
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1036
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Isabella Island, Equador
• Coordinates
  • Lat. (^o): -0.5938889
  • Long. (^o): -91.06944
  • Depth (m): .1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080515	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2247_10509943	F080515	GGAG	MDLDIIAVDGKEVNFKENPFSTVYFENTNPTSESKRIIRVKNSSPILVPFHWAIYKQKNS