Scaffold GOS2232_1011969

Overview

Basic Information

• Taxon OID: 3300001958
• Scaffold ID: GOS2232_1011969
• Source Dataset Name: Marine microbial communities from Gulf of Mexico, USA - GS016
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1654
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Gulf of Mexico, USA
• Coordinates
  • Lat. (^o): 24.174723
  • Long. (^o): -84.344444
  • Depth (m): 2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064809	Metagenome	128	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2232_10119693	F064809	GGAG	MLTTTFTGNITFAEIVTKDGQGNNLDNPFLAIKVAVNDVNDNGLTIAVRTKNGLLEAAQNGEDLVGIRVVIAGSIELPSIRSHWVDNDGNLVALKKPQCRVYANTIERLNRKPAPATVQAELAV*