Scaffold GOS2237_1007401

Overview

Basic Information

• Taxon OID: 3300001955
• Scaffold ID: GOS2237_1007401
• Source Dataset Name: Marine microbial communities from Gulf of Panama, Panama - GS021
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1661
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Rhodobacteraceae → unclassified Rhodobacteraceae → Rhodobacteraceae bacterium HIMB11 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Gulf of Panama, Panama
• Coordinates
  • Lat. (^o): 8.129167
  • Long. (^o): -79.69111
  • Depth (m): 1.6

Associated Families

Family	Category	Number of Sequences	3D Structure?
F046403	Metagenome / Metatranscriptome	151	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2237_10074014	F046403	GGAG	VKHIVVLSALIMTSTLAHAGVMPEDLMLPAVEATTEIAEQIVIEKPTFEEQLNGFMHFVVMS