Scaffold GOS2227_1029336

Overview

Basic Information

• Taxon OID: 3300001950
• Scaffold ID: GOS2227_1029336
• Source Dataset Name: Marine microbial communities from Delaware Bay, New Jersey, USA - GS011
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1336
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Delaware Bay, New Jersey, USA
• Coordinates
  • Lat. (^o): 39.417778
  • Long. (^o): -75.504166
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021519	Metagenome / Metatranscriptome	218	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2227_10293362	F021519	AGGA	MAQNINVRKFAGFAVLAAVINSVVFFIAKAADATMIIKQGGEREITVPMVLGSTLFGLLVAAFFASKIGAKSQSFLSKAPLYGLVFGVVTAAAPFTATDDSKTALGLASMHIVAGLVWFVGSKRSTI*