Scaffold GOS2228_1012991

Overview

Basic Information

• Taxon OID: 3300001948
• Scaffold ID: GOS2228_1012991
• Source Dataset Name: Marine microbial communities from Chesapeake Bay, Maryland, USA - GS012
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1561
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Sphingobacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Chesapeake Bay, Maryland, USA
• Coordinates
  • Lat. (^o): 38.946945
  • Long. (^o): -76.41722
  • Depth (m): 13.2

Associated Families

Family	Category	Number of Sequences	3D Structure?
F102700	Metagenome / Metatranscriptome	101	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2228_10129912	F102700	N/A	LPKGIKKIEKRFIAASERSGSFHALFGNYDIYEFEDGGFVIDAHEECILNHSLQSELKGLGVTLDKAMITAKKDHRHTVVPAGKYFVGIQTRFDPLANAKKNVAD*