Scaffold GOS2244_1019585

Overview

Basic Information

• Taxon OID: 3300001946
• Scaffold ID: GOS2244_1019585
• Source Dataset Name: Marine microbial communities from North James Bay, Santigo Island, Equador
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 929
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (40.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: North James Bay, Santigo Island, Equador
• Coordinates
  • Lat. (^o): -0.2
  • Long. (^o): -90.83528
  • Depth (m): 2.1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028778	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2244_10195852	F028778	AGGAG	MTYDWTLFQTLVFIITPFFLMLALTKKDGDDDDFSGGMMIPDAT*