Basic Information | |
---|---|
Taxon OID | 3300001944 Open in IMG/M |
Scaffold ID | GOS2251_1032065 Open in IMG/M |
Source Dataset Name | Marine microbial communities from Cabo Marshall, Isabella Island, Equador - GS036 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1715 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Cabo Marshall, Isabella Island, Equador | |||||||
Coordinates | Lat. (o) | -0.02083333 | Long. (o) | -91.19778 | Alt. (m) | Depth (m) | 2.1 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F033762 | Metagenome / Metatranscriptome | 176 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2251_10320652 | F033762 | N/A | YTYTHDYAHDLDETYDAWVQSFAHTSQLDEDLDEEYARDAQDYDALAYKHYA* |
⦗Top⦘ |