Scaffold GOS2219_1017875

Overview

Basic Information

• Taxon OID: 3300001941
• Scaffold ID: GOS2219_1017875
• Source Dataset Name: Marine microbial communities from Browns Bank, Gulf of Maine - GS003
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1853
• Total Scaffold Genes: 6
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (16.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Browns Bank, Gulf of Maine, Canada
• Coordinates
  • Lat. (^o): 42.85278
  • Long. (^o): -66.217224
  • Depth (m): 1

Associated Families

Family	Category	Number of Sequences	3D Structure?
F016456	Metagenome / Metatranscriptome	247	N

Sequences

Protein ID	Family	RBS	Sequence
GOS2219_10178755	F016456	N/A	MPKKPNYKDLLKKFKKRNIKNPERIATTYIKGLTAGSKKKAAKNLAGIID*