Scaffold GOS2252_1026433

Overview

Basic Information

• Taxon OID: 3300001937
• Scaffold ID: GOS2252_1026433
• Source Dataset Name: Marine microbial communities from the Equatorial Pacific Ocean - GS037
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: J. Craig Venter Institute (JCVI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1288
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Bellamyvirus → unclassified Bellamyvirus → Synechococcus phage S-SM2 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos)

Source Dataset Sampling Location

• Location Name: Equatorial Pacific Ocean
• Coordinates
  • Lat. (^o): -1.9738889
  • Long. (^o): -95.014725
  • Depth (m): 1.8

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023878	Metagenome / Metatranscriptome	208	Y

Sequences

Protein ID	Family	RBS	Sequence
GOS2252_10264332	F023878	N/A	MELFILIGGLYALYQVGMAIATELDYRETTKQYKK*