Basic Information | |
---|---|
Taxon OID | 3300001937 Open in IMG/M |
Scaffold ID | GOS2252_1014048 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Equatorial Pacific Ocean - GS037 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1237 |
Total Scaffold Genes | 5 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (40.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → Viruses → Predicted Viral | (Source: DeepVirFinder) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Equatorial Pacific Ocean | |||||||
Coordinates | Lat. (o) | -1.9738889 | Long. (o) | -95.014725 | Alt. (m) | Depth (m) | 1.8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F003928 | Metagenome | 461 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2252_10140484 | F003928 | N/A | MNTFTTTAYNSLGQAQETDTQTDSWSATEICLDLSMLYGYAETLDAWGKHCGEYGDRPTALGQRAY* |
⦗Top⦘ |