Basic Information | |
---|---|
Taxon OID | 3300001937 Open in IMG/M |
Scaffold ID | GOS2252_1003553 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the Equatorial Pacific Ocean - GS037 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | J. Craig Venter Institute (JCVI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1008 |
Total Scaffold Genes | 4 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (25.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Global Ocean Sampling (Gos) |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Equatorial Pacific Ocean | |||||||
Coordinates | Lat. (o) | -1.9738889 | Long. (o) | -95.014725 | Alt. (m) | Depth (m) | 1.8 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F037769 | Metagenome | 167 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
GOS2252_10035533 | F037769 | AGAAG | MSYRQTEGDKSDEKLLRRLLSEKMPEKDAKKIINHVFSDLIKWTYEDAVFHLTQIFNFTDEESDQLIKEYDILSSTTKEVIMNPPPSFEATAPRDVNDYKANLWQARKLLVEAKKLISATALTPRDYNNSTDFEEAIVQRMELQSNFVNINKYIDDHLTFAKNYTPPRE* |
⦗Top⦘ |