Scaffold JGI24129J20441_1002100

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI24129J20441_1002100

Scaffold JGI24129J20441_1002100

Overview

Basic Information
Taxon OID	3300001870 Open in IMG/M
Scaffold ID	JGI24129J20441_1002100 Open in IMG/M
Source Dataset Name	Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	6339
Total Scaffold Genes	11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	11 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil → Arctic Peat Soil Microbial Communities From The Barrow Environmental Observatory Site, Barrow, Alaska, Usa

Source Dataset Sampling Location
Location Name	USA: Alaska
Coordinates	Lat. (^o)	71.28381	Long. (^o)	-156.5985	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F039195	Metagenome	164	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24129J20441_10021005	F039195	GGAGG	MVFASVLGLXALFCFLSILLSGDDSEPQVDPRDKLPIWARFGMR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.