Scaffold JGI12627J18819_10058854

Overview

Basic Information

• Taxon OID: 3300001867
• Scaffold ID: JGI12627J18819_10058854
• Source Dataset Name: Texas A ecozone_OM1H0_M2 (Combined assembly for Texas A ecozone Site metagenome samples, ASSEMBLY_DATE=20130705)
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1601
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location

• Location Name: Davy Crockett National Forest, Groveton, Texas, USA
• Coordinates
  • Lat. (^o): 31.11
  • Long. (^o): -95.15

Associated Families

Family	Category	Number of Sequences	3D Structure?
F035449	Metagenome / Metatranscriptome	172	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI12627J18819_100588543	F035449	GGAG	MEYGNTAIIFMVIAVVACGLGVTFFGVYYLNKIVDQNAREGGSVRQP*