 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300001855 Open in IMG/M |
| Scaffold ID | JGI2160J19893_10007265 Open in IMG/M |
| Source Dataset Name | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2793 |
| Total Scaffold Genes | 4 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | White Oak River estuary, North Carolina, USA | |||||||
| Coordinates | Lat. (o) | 34.640199 | Long. (o) | -77.109447 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F090406 | Metagenome | 108 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| JGI2160J19893_100072653 | F090406 | GGA | MKGERKTFWLIIALVGLASCSTTLTSVDKEGGNVYALPPTVVDQMLKDAMSTEISTGTLRRGSTPYPSYLGEVTWGSLDKDTITASARPAKGRKLDGTIIDGYVFEVSRKGTAPATGEPTVKRIFVKLQKDAELTGTGAAFVEFAD* |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |