Scaffold RCM37_1282749

Overview

Basic Information

• Taxon OID: 3300001850
• Scaffold ID: RCM37_1282749
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM37, ROCA_DNA234_0.2um_Ob_C_2a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 520
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (50.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → PVC group → Planctomycetes → Planctomycetia → Planctomycetales → Planctomycetaceae → Planctomyces → Planctomyces bekefii (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Ábidos, Para, Brazil
• Coordinates
  • Lat. (^o): -1.919017
  • Long. (^o): -55.525717

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002687	Metagenome / Metatranscriptome	536	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM37_12827491	F002687	N/A	IIEANVIPSGTATLSSASTYVGNAAVESAIYAVSVEVFQSRLSSGGSIEGVDFSITPYKLGRSLFNKVSGLLGQYMDVEGIAQ*