NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold RCM47_1040460

Scaffold RCM47_1040460


Overview

Basic Information
Taxon OID3300001848 Open in IMG/M
Scaffold IDRCM47_1040460 Open in IMG/M
Source Dataset NameMarine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1913
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (85.71%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location NameSantar?m, Para, Brazil
CoordinatesLat. (o)-2.484383Long. (o)-55.0075Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001915Metagenome / Metatranscriptome617Y
F040590Metagenome161Y

Sequences

Protein IDFamilyRBSSequence
RCM47_10404602F040590GAGGMSAYGKIISGGKAMTKGLTAGINDKLAGFAKENERRKVIAGAVGRAFDQKPLSDNHLNNINGGKFTTPKLPAKV*
RCM47_10404606F001915N/AMEWTLAHPLHDVEDMVLLADQVYGQEVEGILKRDRNVFRKNLTIATTVQIFDKGREFIAVCRDIPFGEQRLLGYCWFDRGGYTTYSSEEISNAKFHHLDLSLPAKQRVRMINEMIDQHILWAHTWGIPLICSTSIRSEHDGFMRIHKKRGFTVNGSYAWIRTEEAMKCL*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.