Scaffold RCM47_1026584

Overview

Basic Information

• Taxon OID: 3300001848
• Scaffold ID: RCM47_1026584
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM47, ROCA_DNA265_0.2um_TAP-S_3a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4296
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Predicted Viral (Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Santar?m, Para, Brazil
• Coordinates
  • Lat. (^o): -2.484383
  • Long. (^o): -55.0075

Associated Families

Family	Category	Number of Sequences	3D Structure?
F021267	Metagenome / Metatranscriptome	219	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM47_10265845	F021267	N/A	MSLTDYQIRDLAKRMSIPLEDVVFKDELEAPLEYNKAYIINIEDSVDENGHPNDGTHWTYLQCNKYPNGKIESIYFDPYGAPPPECVKKVVKETTKQNGLPYTEVDVQSLMNNACGYYCLALGHFINASQYRSNHLYTDVNDFLSLFDDLNKSVDFKKNEYILKHFFRSTDPKLRKAIEVIAPIDKITNEDEKGGIDGFKIPLEIKTINK*