Scaffold RCM41_1016777

Overview

Basic Information

• Taxon OID: 3300001847
• Scaffold ID: RCM41_1016777
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM41. ROCA_DNA251_0.2um_TAP-D_2a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2091
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (28.57%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Synechococcus phage S-H1 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Santar?m, Para, Brazil
• Coordinates
  • Lat. (^o): -2.484383
  • Long. (^o): -55.0075

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015082	Metagenome / Metatranscriptome	257	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM41_10167776	F015082	N/A	MNDSDIYWTFTTAIEYGGGFFQALAHAGLKADQANKRRILAAFPEIVATYGTASKLHRHLREGIAA*