Scaffold RCM35_1013514

Overview

Basic Information

• Taxon OID: 3300001844
• Scaffold ID: RCM35_1013514
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 6172
• Total Scaffold Genes: 17
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 12 (70.59%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Methylophilaceae → unclassified Methylophilaceae → Methylophilaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Ponta de Pedras, Para, Brazil
• Coordinates
  • Lat. (^o): -1.519367
  • Long. (^o): -48.91795

Associated Families

Family	Category	Number of Sequences	3D Structure?
F000473	Metagenome / Metatranscriptome	1097	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM35_101351415	F000473	AGGA	MASDKDHFRYGINQWTGEPNKPVFYTDEMKKRIWEIPKPAMLLLDIVKYPEFLALRLYEDNFIQFDGTKKEIVIDYVSKVKKLIESYGVRCELEGVPSARVL*