Scaffold RCM39_1076463

Overview

Basic Information

• Taxon OID: 3300001837
• Scaffold ID: RCM39_1076463
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM39, ROCA_DNA237_0.2um_Ob_C_3a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1023
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Ábidos, Para, Brazil
• Coordinates
  • Lat. (^o): -1.919017
  • Long. (^o): -55.525717

Associated Families

Family	Category	Number of Sequences	3D Structure?
F069736	Metagenome / Metatranscriptome	123	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM39_10764633	F069736	N/A	VLENWLNPGAAPSDDEIVEELEAPKPKAQPVAQKQPSADMGGVSEIGGTGIMEDLPWENEAPKKAADDVASAFDDLFNN*