Scaffold RCM27_1018498

Overview

Basic Information

• Taxon OID: 3300001836
• Scaffold ID: RCM27_1018498
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM27, ROCA_DNA191_0.2um_MCP-N_C_3a
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 2389
• Total Scaffold Genes: 7
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (42.86%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Afu?, Para, Brazil
• Coordinates
  • Lat. (^o): -0.083883
  • Long. (^o): -51.051417

Associated Families

Family	Category	Number of Sequences	3D Structure?
F023092	Metagenome / Metatranscriptome	211	Y

Sequences

Protein ID	Family	RBS	Sequence
RCM27_10184983	F023092	N/A	MSKVKNNPVKLINKYTKEEVYTRDYNDVIKEGANEFIRVFNANNPNRTYLVNRTAFHVAK