Scaffold ACM2_1045267

Overview

Basic Information

• Taxon OID: 3300001834
• Scaffold ID: ACM2_1045267
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM2, ROCA_DNA019_0.2um_2g
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1017
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Crocinitomicaceae → unclassified Crocinitomicaceae → Crocinitomicaceae bacterium TMED45 (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 10.2885
  • Long. (^o): -54.512

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028831	Metagenome / Metatranscriptome	190	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM2_10452672	F028831	GAGG	MKYTNEQIKAGVKFLANKNVSFELDGDEDKQVGIHIDVHNNRIWTGGDSIWNNCVVKGVKVDYISLRANYDNWDEDAYWSGGLSGTIAYDGSGKDGTWYDGGDLDGGMLINKFKDEQDSDGMIYTDSGFIANSIKYMEQHCDFDAKLLSDFLDFDYSEQGMQDDGAVNLDVDLDGHFWIKCNDELVKFVNTKVA*