Basic Information | |
---|---|
Taxon OID | 3300001833 Open in IMG/M |
Scaffold ID | ACM24_1075961 Open in IMG/M |
Source Dataset Name | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM24, ROCA_DNA012_0.2um_2l |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 511 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Amazon River plume to Atlantic Ocean | |||||||
Coordinates | Lat. (o) | 10.2885 | Long. (o) | -54.512 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F016980 | Metagenome | 243 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
ACM24_10759613 | F016980 | AGG | MKYRELLDQLEELTQDQLELETLVFIRDKEKFVRLNNSLYFVTEFDEYDQELETDYPYFRL* |
⦗Top⦘ |