Scaffold ACM6_1066040

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold ACM6_1066040

Scaffold ACM6_1066040

Overview

Basic Information
Taxon OID	3300001832 Open in IMG/M
Scaffold ID	ACM6_1066040 Open in IMG/M
Source Dataset Name	Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM6, ROCA_DNA131_0.2um_27b
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	758
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	3 (75.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location
Location Name	Amazon River plume to Atlantic Ocean
Coordinates	Lat. (^o)	12.4145	Long. (^o)	-52.2197	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015717	Metagenome	252	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM6_10660404	F015717	GAGG	MTQDKLEYQFKKAFLEQESEKYIDYLCEPRTKPEVYAAIEKIALIQLQIKNCDDIIYTANIPKFDDPLF*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.