Scaffold ACM4_1010085

Overview

Basic Information

• Taxon OID: 3300001831
• Scaffold ID: ACM4_1010085
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM4, ROCA_DNA074_0.2um_10l
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 4411
• Total Scaffold Genes: 9
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Siphoviridae → unclassified Siphoviridae → Synechococcus phage S-CBS3 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 4.8818
  • Long. (^o): -51.3608

Associated Families

Family	Category	Number of Sequences	3D Structure?
F015093	Metagenome / Metatranscriptome	257	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM4_10100858	F015093	GGAG	MRIQMLRSTIVDLKPVQIGDFVETDQKSALLLIGIGKAMPAPLPQEVVIEAEKEPQLDKPAPKRRKTNASQPRV*