Scaffold ACM21_1005040

Overview

Basic Information

• Taxon OID: 3300001827
• Scaffold ID: ACM21_1005040
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 784
• Total Scaffold Genes: 5
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 3 (60.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → unclassified Gammaproteobacteria → gamma proteobacterium SCGC AAA160-D02 (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 10.6822
  • Long. (^o): -54.4213

Associated Families

Family	Category	Number of Sequences	3D Structure?
F045156	Metagenome / Metatranscriptome	153	Y

Sequences

Protein ID	Family	RBS	Sequence
ACM21_10050402	F045156	AGG	MPHAGNFKFKALHKQKGRLSMRRNQGKPGNVTREEFNENWDRIFKKSEGLNKNKEDKDANKD*