Scaffold JGI24123J20310_1001534

Overview

Basic Information

• Taxon OID: 3300001813
• Scaffold ID: JGI24123J20310_1001534
• Source Dataset Name: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_5A
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 9019
• Total Scaffold Genes: 10
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 7 (70.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Source Dataset Sampling Location

• Location Name: USA: California, McLaughlin Reserve
• Coordinates
  • Lat. (^o): 38.8739528
  • Long. (^o): -122.4391613

Associated Families

Family	Category	Number of Sequences	3D Structure?
F018837	Metagenome / Metatranscriptome	233	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24123J20310_10015341	F018837	N/A	TIFDDLHKRYGAASAEQKLVVLRRELLRPIITVETSAHLLQTVGDQICNCLPDEISPEEFKNTITWLNEAARDLHQVLDALTADVSQVQGQHGIK*