Scaffold JGI20218J20341_1053851

Overview

Basic Information

• Taxon OID: 3300001808
• Scaffold ID: JGI20218J20341_1053851
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site L1 Bulk Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1185
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Twitchell Island, Sacramento and San Joaquin Delta, California, USA
• Coordinates
  • Lat. (^o): 38.1067
  • Long. (^o): -121.6464
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F067889	Metagenome / Metatranscriptome	125	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20218J20341_10538511	F067889	AGG	MVKSHEHKEEDVRKLIAAAAILAVVFVIGCQDTKKVTELQGSVDKLTQQVTDMTGQVAKLTAERDSLAKVITDMTAKMPPAKGGTKPPVSKGTGGGTVKPPTKK*