Scaffold JGI20216J20342_1001342

Overview

Basic Information

• Taxon OID: 3300001806
• Scaffold ID: JGI20216J20342_1001342
• Source Dataset Name: Wetland microbial communities from Twitchell Island in the Sacramento Delta, sample from surface sediment Feb2011 Site A1 Bulk Metatranscriptome (Metagenome Metatranscriptome)
• Source Dataset Category: Metatranscriptome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 612
• Total Scaffold Genes: 2
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: Not Available (Source: )

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland → Microbial Community Impact On Carbon Sequestration In Managed Wetland Carbon Farming

Source Dataset Sampling Location

• Location Name: Twitchell Island, Sacramento and San Joaquin Delta, California, USA
• Coordinates
  • Lat. (^o): 38.107
  • Long. (^o): -121.6475
  • Depth (m): 0

Associated Families

Family	Category	Number of Sequences	3D Structure?
F052605	Metagenome / Metatranscriptome	142	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20216J20342_10013421	F052605	N/A	GKIKVVRFKIIPGDWGKAGSGWLTRLLLTAPLGPAEAEFTSSSGGVRTPSNANEELGSEKRLEAASS*