Scaffold JGI24115J20150_1004749

Overview

Basic Information

• Taxon OID: 3300001800
• Scaffold ID: JGI24115J20150_1004749
• Source Dataset Name: Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Mar_CSW14AB
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Center: DOE Joint Genome Institute (JGI)
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 3365
• Total Scaffold Genes: 4
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (25.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 0 (0.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid → Serpentinite Rock And Fluid Microbial Communities From Tablelands Ophiolite (Newfoundland), Coast Range Ophiolite (California) And Ligurian Springs (Italy)

Source Dataset Sampling Location

• Location Name: USA: California, McLaughlin Reserve
• Coordinates
  • Lat. (^o): 38.8739528
  • Long. (^o): -122.4391613

Associated Families

Family	Category	Number of Sequences	3D Structure?
F080069	Metagenome / Metatranscriptome	115	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI24115J20150_10047491	F080069	N/A	MKPRRTLRALAAALGCTVALSGVMPAFARAQDDVTGDWLFDTSKFADNDCQISGRITFKPTAVKNTYTCVFESEQICGKLNGNLYIRVRQVCTAQRIGKQVAIKTKVDKILERRPVIPYPEDYYLADNFILQIAPNKAEMNGSHYDEQRQLKARFWR