Scaffold BP130528S2_1721004

Overview

Basic Information

• Taxon OID: 3300001789
• Scaffold ID: BP130528S2_1721004
• Source Dataset Name: BioPara_130528_S2
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 560
• Total Scaffold Genes: 1
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Tripsacinae → Zea → Zea mays (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Engineered → Solid Waste → Grass → Composting → Bioreactor → Biogas Reactor → Biogas Reactor Microbial Communities From The Max Planck Institute, Germany

Source Dataset Sampling Location

• Coordinates

Associated Families

Family	Category	Number of Sequences	3D Structure?
F066897	Metagenome / Metatranscriptome	126	Y

Sequences

Protein ID	Family	RBS	Sequence
BP130528S2_17210041	F066897	GGAGG	MSSKWFWLILIAIILVSSVFLWHNHTSTQEALIKAQETIKETKQALRESQDALQRIDEITQKLQDVTRMAKEAGDKRVEEIKYVSDDDFLNIANQYSALMVERVDF*