Basic Information | |
---|---|
Taxon OID | 3300001785 Open in IMG/M |
Scaffold ID | BP130709S4_1461876 Open in IMG/M |
Source Dataset Name | BioPara_130709_S4 |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 623 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Alcaligenaceae → unclassified Alcaligenaceae → Alcaligenaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Engineered → Solid Waste → Grass → Composting → Bioreactor → Biogas Reactor → Biogas Reactor Microbial Communities From The Max Planck Institute, Germany |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | ||||||||
Coordinates | Lat. (o) | Long. (o) | Alt. (m) | Depth (m) | Location on Map | |||
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F095115 | Metagenome / Metatranscriptome | 105 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
BP130709S4_14618761 | F095115 | AGGGGG | MMIETMKKALERAMVKSENPTKIKEYMEEYFDNIGGDRRYKFKWRAICGNHKYTFSGIFEYYGKTYYFNKIGNELELKYYK* |
⦗Top⦘ |