Basic Information | |
---|---|
Taxon OID | 3300001782 Open in IMG/M |
Scaffold ID | WOR52_10028167 Open in IMG/M |
Source Dataset Name | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samples |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 14216 |
Total Scaffold Genes | 27 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 18 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Archaea | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | White Oak River estuary, North Carolina, USA | |||||||
Coordinates | Lat. (o) | 34.6478111 | Long. (o) | -77.1112083 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F059606 | Metagenome / Metatranscriptome | 133 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
WOR52_100281676 | F059606 | N/A | MSIVVKMKSEQAIALVALILGIVGGALLLRDGIHVVSELFEGNRHINFESLLLVGIGVVAIIASAMLWTGRYLAAGVVNMVLGIITVFYGRDAEGLMILISGILGIVAPKIKD* |
⦗Top⦘ |