NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold WOR52_10010764

Scaffold WOR52_10010764


Overview

Basic Information
Taxon OID3300001782 Open in IMG/M
Scaffold IDWOR52_10010764 Open in IMG/M
Source Dataset NameMarine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samples
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)10472
Total Scaffold Genes18 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)15 (83.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Archaea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment → Marine Sediment Microbial Communities From White Oak River Estuary, North Carolina

Source Dataset Sampling Location
Location NameWhite Oak River estuary, North Carolina, USA
CoordinatesLat. (o)34.6478111Long. (o)-77.1112083Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F009657Metagenome / Metatranscriptome315Y
F078166Metagenome116Y

Sequences

Protein IDFamilyRBSSequence
WOR52_1001076416F009657GAGGMKEYEILSDTGTCRKLVAKINRMAKEGWRAKSIGGLGAPTGISAVYVLMEREV*
WOR52_100107647F078166GAGVIGMSVSENVFLEDTNKGGYKLAIVARFAEPFPVQYVIRLSTPKGANVEYMSTLEGFKNFGELLTALHYFAQTKLYPQDLQKLREVLTAENIKNFAEVLKAAKFSV*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.