Scaffold Deep_1020012

Overview

Basic Information

• Taxon OID: 3300001781
• Scaffold ID: Deep_1020012
• Source Dataset Name: Hydrothermal vent plume microbial communities from the Mid Cayman Rise - Deep Sites
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1798
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 2 (66.67%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria (Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume → Hydrothermal Vent Plume Microbial Communities From The Cayman Rise, Cayman Islands

Source Dataset Sampling Location

• Location Name: Mid Cayman Rise, Cayman Islands, UK
• Coordinates
  • Lat. (^o): 18.35
  • Long. (^o): -81.85
  • Depth (m): 4000

Associated Families

Family	Category	Number of Sequences	3D Structure?
F062154	Metagenome / Metatranscriptome	131	N

Sequences

Protein ID	Family	RBS	Sequence
Deep_10200121	F062154	AGGA	VGVNGVKVLSVVNARPERLVNNVANGVRAPSVVNARPERLVNGVRVPSVVNARPERLVNGVRVPSVVNVRPELVVSVVRVDHSSVAAVVREAQVVFCGCSL*