Scaffold ACM18_1018578

Overview

Basic Information

• Taxon OID: 3300001778
• Scaffold ID: ACM18_1018578
• Source Dataset Name: Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM18, ROCA_DNA027_0.2um_3g
• Source Dataset Category: Metagenome
• Source Dataset Use Policy: Open
• Sequencing Status: Permanent Draft

Scaffold Components

• Scaffold Length (bps): 1134
• Total Scaffold Genes: 3
• Total Scaffold Genes with Ribosome Binding Sites (RBS): 1 (33.33%)
• Novel Protein Genes: 1
• Novel Protein Genes with Ribosome Binding Sites (RBS): 1 (100.00%)
• Associated Families: 1

Taxonomy: All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium (Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem: Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton → Marine Plankton Microbial Communities From The Amazon River Plume, Atlantic Ocean

Source Dataset Sampling Location

• Location Name: Amazon River plume to Atlantic Ocean
• Coordinates
  • Lat. (^o): 7.2875
  • Long. (^o): -53.0005

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077165	Metagenome / Metatranscriptome	117	N

Sequences

Protein ID	Family	RBS	Sequence
ACM18_10185782	F077165	AGGAG	MDILGGMSSSNESQQVYLAFKTMHQQFFANGETPVEFQYLQLDPATFKSGWGRYTRADGFEYQWDEKFGVVSPKPAEDFKRAFSAWVFPQGAQHAYLWQRFTYA